Structure of PDB 5gt0 Chain C Binding Site BS02

Receptor Information
>5gt0 Chain C (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEIL
ELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQA
VLLPKK
Ligand information
>5gt0 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gt0 Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
Resolution2.82 Å
Binding residue
(original residue number in PDB)
S14 R29 R42 I43 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)
S1 R16 R29 I30 A32 K62 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5gt0, PDBe:5gt0, PDBj:5gt0
PDBsum5gt0
PubMed27992841
UniProtQ96QV6|H2A1A_HUMAN Histone H2A type 1-A (Gene Name=H2AC1)

[Back to BioLiP]