Structure of PDB 5gio Chain C Binding Site BS02

Receptor Information
>5gio Chain C (length=122) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVII
AEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILE
PGEAKDLVDEIIKRVNEIKGKT
Ligand information
>5gio Chain H (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugugaugaaacacucauggucugaagacuccc
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gio Box C/D guide RNAs recognize a maximum of 10 nt of substrates
Resolution3.604 Å
Binding residue
(original residue number in PDB)
K37 G38 T39 N40 E41 V60 Q61 I65 K86 L95 A98 T99 A100
Binding residue
(residue number reindexed from 1)
K31 G32 T33 N34 E35 V54 Q55 I59 K80 L89 A92 T93 A94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5gio, PDBe:5gio, PDBj:5gio
PDBsum5gio
PubMed27625427
UniProtP55858|RL7A_SACS2 Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]