Structure of PDB 5f6k Chain C Binding Site BS02

Receptor Information
>5f6k Chain C (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGT
IIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAP
NCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFIPCHCGAVNCRKWMN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f6k Structural basis for activity regulation of MLL family methyltransferases.
Resolution2.411 Å
Binding residue
(original residue number in PDB)
N4811 E4814 V4824 M4826 F4827 Y4886 K4887 F4888
Binding residue
(residue number reindexed from 1)
N58 E61 V71 M73 F74 Y133 K134 F135
Enzymatic activity
Catalytic site (original residue number in PDB) Y4800 I4876
Catalytic site (residue number reindexed from 1) Y47 I123
Enzyme Commision number 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
External links
PDB RCSB:5f6k, PDBe:5f6k, PDBj:5f6k
PDBsum5f6k
PubMed26886794
UniProtQ8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C (Gene Name=KMT2C)

[Back to BioLiP]