Structure of PDB 5els Chain C Binding Site BS02

Receptor Information
>5els Chain C (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSI
LGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHA
LEEIKKFLIPDYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5els Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
Resolution2.873 Å
Binding residue
(original residue number in PDB)
N71 G74 K75 L77 G78 P79 R80 L84 K85 I97 R104
Binding residue
(residue number reindexed from 1)
N24 G27 K28 L30 G31 P32 R33 L37 K38 I50 R57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5els, PDBe:5els, PDBj:5els
PDBsum5els
PubMed26758068
UniProtO75525|KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 (Gene Name=KHDRBS3)

[Back to BioLiP]