Structure of PDB 5e6o Chain C Binding Site BS02

Receptor Information
>5e6o Chain C (length=114) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLV
PEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERD
PDGFVYMVYTSQPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e6o Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q37 K61 F62 L63 R80 F118
Binding residue
(residue number reindexed from 1)		Q23 K47 F48 L49 R66 F104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5e6o, PDBe:5e6o, PDBj:5e6o
PDBsum5e6o
PubMed26687600
UniProtQ23536|LGG2_CAEEL Protein lgg-2 (Gene Name=lgg-2)

[Back to BioLiP]