Structure of PDB 5dir Chain C Binding Site BS02

Receptor Information

>5dir Chain C (length=149) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTLAYNTGAAFS
FLADSSGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGAL
GNLYDRMVLGHVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALDMFR

Ligand information

>5dir Chain G (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LIST

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dir Structural basis of lipoprotein signal peptidase II action and inhibition by the antibiotic globomycin.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	F73 R116
Binding residue (residue number reindexed from 1)	F63 R106

Enzymatic activity

Enzyme Commision number

3.4.23.36: signal peptidase II.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006465	signal peptide processing
GO:0006508	proteolysis

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dir, PDBe:5dir, PDBj:5dir
PDBsum	5dir
PubMed	26912896
UniProt	Q9HVM5\|LSPA_PSEAE Lipoprotein signal peptidase (Gene Name=lspA)

[Back to BioLiP]