Structure of PDB 5c13 Chain C Binding Site BS02

Receptor Information
>5c13 Chain C (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPE
EMQWFCPKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c13 Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
Resolution2.101 Å
Binding residue
(original residue number in PDB)
M856 Y857 V858 I859 R860
Binding residue
(residue number reindexed from 1)
M1 Y2 V3 I4 R5
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5c13, PDBe:5c13, PDBj:5c13
PDBsum5c13
PubMed
UniProtQ5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit 3 (Gene Name=TAF3)

[Back to BioLiP]