Structure of PDB 4zux Chain C Binding Site BS02

Receptor Information
>4zux Chain C (length=103) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVL
LPK
Ligand information
>4zux Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zux Structural basis for histone H2B deubiquitination by the SAGA DUB module.
Resolution3.82 Å
Binding residue
(original residue number in PDB)
R29 R35 R42 V43 G44 A45 K75 T76
Binding residue
(residue number reindexed from 1)
R14 R20 R27 V28 G29 A30 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4zux, PDBe:4zux, PDBj:4zux
PDBsum4zux
PubMed26912860
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]