Structure of PDB 4y60 Chain C Binding Site BS02

Receptor Information
>4y60 Chain C (length=76) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEK
RPFVEEAERLRVQHLRDHPNYKYRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y60 Structure and decoy-mediated inhibition of the SOX18/Prox1-DNA interaction.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R2 R4 R5 M7 M11 K15 R18 N30 Y72 R75
Binding residue
(residue number reindexed from 1)		R3 R5 R6 M8 M12 K16 R19 N31 Y73 R76
Binding affinityPDBbind-CN: Kd=6.1nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4y60, PDBe:4y60, PDBj:4y60
PDBsum4y60
PubMed26939885
UniProtP43680|SOX18_MOUSE Transcription factor SOX-18 (Gene Name=Sox18)

[Back to BioLiP]