Structure of PDB 4u0y Chain C Binding Site BS02

Receptor Information

>4u0y Chain C (length=75) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMT
VRQALSNLVNEGLLYRLKGRGTFVS

Ligand information

>4u0y Chain F (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtggtctagaccact

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4u0y Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
Resolution	1.91 Å
Binding residue (original residue number in PDB)	S36 E37 R52 R66 G69 R70 G71 T72
Binding residue (residue number reindexed from 1)	S36 E37 R52 R66 G69 R70 G71 T72

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4u0y, PDBe:4u0y, PDBj:4u0y
PDBsum	4u0y
PubMed	25564531
UniProt	O34817\|NAGR_BACSU HTH-type transcriptional repressor NagR (Gene Name=nagR)

[Back to BioLiP]