Structure of PDB 4rqi Chain C Binding Site BS02

Receptor Information
>4rqi Chain C (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGK
EHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEF
TLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN
DLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKA
LK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rqi A higher-order entity formed by the flexible assembly of RAP1 with TRF2.
Resolution2.4405 Å
Binding residue
(original residue number in PDB)		D75 Q78
Binding residue
(residue number reindexed from 1)		D32 Q35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rqi, PDBe:4rqi, PDBj:4rqi
PDBsum4rqi
PubMed26748096
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]