Structure of PDB 4r6r Chain C Binding Site BS02

Receptor Information
>4r6r Chain C (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>4r6r Chain D (length=14) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGISQTVIVGPWGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r6r Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
Resolution1.38 Å
Binding residue
(original residue number in PDB)		T72 F104 L106 D125 Y126 F127 S128 M129 Y130 L131
Binding residue
(residue number reindexed from 1)		T72 F104 L106 D125 Y126 F127 S128 M129 Y130 L131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4r6r, PDBe:4r6r, PDBj:4r6r
PDBsum4r6r
PubMed25664742
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]