Structure of PDB 4ni9 Chain C Binding Site BS02

Receptor Information
>4ni9 Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQPLTSSERIDKQIRYILDGISALRKETNNLNLPKMAEKDGCFQSGFNEE
TCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAI
TTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ni9 Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		R24 K27 Q28 R30 Y31 R113 M117 S118 V121 Q124 F125 K128 Q175 R179
Binding residue
(residue number reindexed from 1)		R9 K12 Q13 R15 Y16 R82 M86 S87 V90 Q93 F94 K97 Q139 R143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005138 interleukin-6 receptor binding
Biological Process
GO:0006955 immune response
GO:0030154 cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ni9, PDBe:4ni9, PDBj:4ni9
PDBsum4ni9
PubMed24415767
UniProtP05231|IL6_HUMAN Interleukin-6 (Gene Name=IL6)

[Back to BioLiP]