Structure of PDB 4ld9 Chain C Binding Site BS02

Receptor Information
>4ld9 Chain C (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Ligand information
>4ld9 Chain J (length=142) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaatcccggtgccgaggccgctcaattggtcgtagacagctctagcacc
gcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggat
tactccctagtctccaggcacgtgtcagatatatacatcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ld9 The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
Resolution3.306 Å
Binding residue
(original residue number in PDB)		R29 R35 R42 V43 G44 A45 K75 R77
Binding residue
(residue number reindexed from 1)		R10 R16 R23 V24 G25 A26 K56 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4ld9, PDBe:4ld9, PDBj:4ld9
PDBsum4ld9
PubMed23934150
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]