Structure of PDB 4kpe Chain C Binding Site BS02

Receptor Information
>4kpe Chain C (length=208) Species: 170187 (Streptococcus pneumoniae TIGR4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAK
AKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHI
QTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKG
LGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKW
IEDNVKFT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kpe Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
Resolution3.43 Å
Binding residue
(original residue number in PDB)		K458 I460 N461 K464 H513 V626 R629 R630
Binding residue
(residue number reindexed from 1)		K44 I46 N47 K50 H99 V194 R197 R198
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4kpe, PDBe:4kpe, PDBj:4kpe
PDBsum4kpe
PubMed27655731
UniProtQ59961|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]