Structure of PDB 4jol Chain C Binding Site BS02

Receptor Information
>4jol Chain C (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELN
YWIRRYSDAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jol A stable transcription factor complex nucleated by oligomeric AML1-ETO controls leukaemogenesis.
Resolution2.906 Å
Binding residue
(original residue number in PDB)		S522 V525
Binding residue
(residue number reindexed from 1)		S34 V37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jol, PDBe:4jol, PDBj:4jol
PDBsum4jol
PubMed23812588
UniProtQ06455|MTG8_HUMAN Protein CBFA2T1 (Gene Name=RUNX1T1)

[Back to BioLiP]