Structure of PDB 4hp1 Chain C Binding Site BS02

Receptor Information
>4hp1 Chain C (length=51) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKKRKRCGVCVPCLRKEPCGACYNCVNRSTSHQICKMRKCEQLKKKRVVP
M
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hp1 Tet3 CXXC Domain and Dioxygenase Activity Cooperatively Regulate Key Genes for Xenopus Eye and Neural Development.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		H90 Q91
Binding residue
(residue number reindexed from 1)		H32 Q33
Binding affinityPDBbind-CN: Kd=7uM
Enzymatic activity
Enzyme Commision number 1.14.11.80: methylcytosine dioxygenase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4hp1, PDBe:4hp1, PDBj:4hp1
PDBsum4hp1
PubMed23217707
UniProtA0JP82|TET3_XENTR Methylcytosine dioxygenase tet3 (Gene Name=tet3)

[Back to BioLiP]