Structure of PDB 4gzn Chain C Binding Site BS02

Receptor Information
>4gzn Chain C (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNR
HLKVHQNKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gzn An atomic model of Zfp57 recognition of CpG methylation within a specific DNA sequence.
Resolution0.99 Å
Binding residue
(original residue number in PDB)		R138 Y149 R150 S153 R166 K175 R178 E182 R185 H186 V189
Binding residue
(residue number reindexed from 1)		R3 Y14 R15 S18 R31 K40 R43 E47 R50 H51 V54
Binding affinityPDBbind-CN: Kd=8nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4gzn, PDBe:4gzn, PDBj:4gzn
PDBsum4gzn
PubMed23059534
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]