Structure of PDB 4g92 Chain C Binding Site BS02

Receptor Information
>4g92 Chain C (length=117) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVM
KADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIA
AALSKSDMFDFLIDIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g92 DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		P88 L89 A90 R91 K94
Binding residue
(residue number reindexed from 1)		P42 L43 A44 R45 K48
Binding affinityPDBbind-CN: Kd=3.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4g92, PDBe:4g92, PDBj:4g92
PDBsum4g92
PubMed22902862
UniProtC8V0B5

[Back to BioLiP]