Structure of PDB 4cz5 Chain C Binding Site BS02

Receptor Information
>4cz5 Chain C (length=32) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEEIFTLQVRGRERYEILKKLNDSLELSDVV
Ligand information
>4cz5 Chain D (length=29) Species: 7955 (Danio rerio) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIFTLQVRGRERYEILKKLNDSLELSDVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cz5 Tracing the Evolution of the P53 Tetramerization Domain
Resolution1.02 Å
Binding residue
(original residue number in PDB)		E302 E303 I304 F305 T306 L307 Q308 V309 R310 G311 R312 E313 R314 Y315 L318 N322 L325 E326 V331
Binding residue
(residue number reindexed from 1)		E3 E4 I5 F6 T7 L8 Q9 V10 R11 G12 R13 E14 R15 Y16 L19 N23 L26 E27 V32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051262 protein tetramerization

View graph for
Biological Process
External links
PDB RCSB:4cz5, PDBe:4cz5, PDBj:4cz5
PDBsum4cz5
PubMed25185827
UniProtP79734|P53_DANRE Cellular tumor antigen p53 (Gene Name=tp53)

[Back to BioLiP]