Structure of PDB 3x1u Chain C Binding Site BS02

Receptor Information
>3x1u Chain C (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVL
ELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQA
VLLPK
Ligand information
>3x1u Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3x1u Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		R42 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R29 G31 A32 K62 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x1u, PDBe:3x1u, PDBj:3x1u
PDBsum3x1u
PubMed26188507
UniProtQ8CGP4

[Back to BioLiP]