Structure of PDB 3wts Chain C Binding Site BS02

Receptor Information
>3wts Chain C (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDP
DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDL
QSLLGYTPEELHAMLDVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wts A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
G333 P334 R391 R394 Y397 K404 K408 R409 Y410
Binding residue
(residue number reindexed from 1)
G15 P16 R73 R76 Y79 K86 K90 R91 Y92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3wts, PDBe:3wts, PDBj:3wts
PDBsum3wts
PubMed25083921
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]