Structure of PDB 3vek Chain C Binding Site BS02

Receptor Information

>3vek Chain C (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS

Ligand information

>3vek Chain B (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagagtccatctgataagac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vek GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
Resolution	2.63 Å
Binding residue (original residue number in PDB)	P213 L214 N226 L230 Y231 R239 L268 R270 R271 K287 R305 N306 R307
Binding residue (residue number reindexed from 1)	P13 L14 N26 L30 Y31 R39 L54 R56 R57 K73 R91 N92 R93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3vek, PDBe:3vek, PDBj:3vek
PDBsum	3vek
PubMed	26234528
UniProt	P17679\|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)

[Back to BioLiP]