Structure of PDB 3vd6 Chain C Binding Site BS02

Receptor Information
>3vd6 Chain C (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLTQCTNCQTT
TTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vd6 GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		P213 N226 L230 R239 L268 R270 R271 K287 R305 N306 R307
Binding residue
(residue number reindexed from 1)		P13 N26 L30 R39 L54 R56 R57 K73 R91 N92 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3vd6, PDBe:3vd6, PDBj:3vd6
PDBsum3vd6
PubMed26234528
UniProtP17679|GATA1_MOUSE Erythroid transcription factor (Gene Name=Gata1)

[Back to BioLiP]