Structure of PDB 3udg Chain C Binding Site BS02

Receptor Information
>3udg Chain C (length=214) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIRERNLPWYHRV
SILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRM
EQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSL
SIAVNENYQDGQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNE
STRVEATRVEALAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3udg Structure and Cellular Dynamics of Deinococcus radiodurans Single-stranded DNA (ssDNA)-binding Protein (SSB)-DNA Complexes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R3 N137 T139 N161 Y177 K195
Binding residue
(residue number reindexed from 1)		R1 N131 T133 N155 Y169 K187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006310 DNA recombination
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3udg, PDBe:3udg, PDBj:3udg
PDBsum3udg
PubMed22570477
UniProtQ9RY51|SSB_DEIRA Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]