Structure of PDB 3u58 Chain C Binding Site BS02

Receptor Information

>3u58 Chain C (length=211) Species: 5911 (Tetrahymena thermophila)

GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFI
TAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFK
FGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIR
LKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQL
KNNIHSSIKES

Ligand information

>3u58 Chain G (length=4)

gggt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3u58 Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
• Resolution: 2.613 Å
• Binding residue (original residue number in PDB): Y249 F251 N263 S265 W267 K291 F293 E298 K300 K302
• Binding residue (residue number reindexed from 1): Y47 F49 N61 S63 W65 K89 F91 E96 K98 K100

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 05:33:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3u58', asym_id = 'C', bs = 'BS02', title = 'Structural basis for Tetrahymena telomerase proc... binding to single-stranded telomeric-repeat DNA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3u58', asym_id='C', bs='BS02', title='Structural basis for Tetrahymena telomerase proc... binding to single-stranded telomeric-repeat DNA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003676', uniprot = '', pdbid = '3u58', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676', uniprot='', pdbid='3u58', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>