Structure of PDB 3u2b Chain C Binding Site BS02

Receptor Information
>3u2b Chain C (length=76) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKI
PFIQEAERLRLKHMADYPDYKYRPRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u2b The crystal structure of the Sox4 HMG domain-DNA complex suggests a mechanism for positional interdependence in DNA recognition
Resolution2.402 Å
Binding residue
(original residue number in PDB)		H2 K4 R5 M7 Q15 R18 H29 N30 Y72 P74
Binding residue
(residue number reindexed from 1)		H2 K4 R5 M7 Q15 R18 H29 N30 Y72 P74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3u2b, PDBe:3u2b, PDBj:3u2b
PDBsum3u2b
PubMed22181698
UniProtQ06831|SOX4_MOUSE Transcription factor SOX-4 (Gene Name=Sox4)

[Back to BioLiP]