Structure of PDB 3tpx Chain C Binding Site BS02

Receptor Information
>3tpx Chain C (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tpx An Ultrahigh Affinity d-Peptide Antagonist Of MDM2.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K51 L54 F55 I61 M62 Y67 Q72 H73 V93 K94 I99 Y100
Binding residue
(residue number reindexed from 1)		K26 L29 F30 I36 M37 Y42 Q47 H48 V68 K69 I74 Y75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3tpx, PDBe:3tpx, PDBj:3tpx
PDBsum3tpx
PubMed22694121
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]