Structure of PDB 3rad Chain C Binding Site BS02

Receptor Information

>3rad Chain C (length=209) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTA
KAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAH
IQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYK
GLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRK
WIEDNVKFT

Ligand information

>3rad Chain F (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agtcattcatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rad Exploring the active site of the Streptococcus pneumoniae topoisomerase IV-DNA cleavage complex with novel 7,8-bridged fluoroquinolones.
Resolution	3.35 Å
Binding residue (original residue number in PDB)	K458 I460 N461 K464 N473 H513 V626 R629
Binding residue (residue number reindexed from 1)	K45 I47 N48 K51 N60 H100 V195 R198

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3rad, PDBe:3rad, PDBj:3rad
PDBsum	3rad
PubMed	27655731
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]