Structure of PDB 3qsv Chain C Binding Site BS02

Receptor Information
>3qsv Chain C (length=124) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAIT
TNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHV
KYCQYAFDLKCDSVCVNPYHYERV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qsv Structural basis for DNA recognition by constitutive Smad4 MH1 dimers
Resolution2.708 Å
Binding residue
(original residue number in PDB)		R38 T77 L78 L82 Q83 K88
Binding residue
(residue number reindexed from 1)		R26 T65 L66 L70 Q71 K76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qsv, PDBe:3qsv, PDBj:3qsv
PDBsum3qsv
PubMed
UniProtP97471|SMAD4_MOUSE Mothers against decapentaplegic homolog 4 (Gene Name=Smad4)

[Back to BioLiP]