Structure of PDB 3qo2 Chain C Binding Site BS02

Receptor Information
>3qo2 Chain C (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLE
FRKKIAENK
Ligand information
>3qo2 Chain R (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RTKQTARKSTGGKA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qo2 Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		D57 V58 F59 E60 V61 W80 Y83 E91 H95 D98 C99 E101 V102
Binding residue
(residue number reindexed from 1)		D2 V3 F4 E5 V6 W25 Y28 E36 H40 D43 C44 E46 V47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3qo2, PDBe:3qo2, PDBj:3qo2
PDBsum3qo2
PubMed21419134
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]