Structure of PDB 3oqn Chain C Binding Site BS02

Receptor Information
>3oqn Chain C (length=332) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNA
VARGLASKKTTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQ
NMEKELHLLNTMLGKQVDGIVFMGGNITDEHVAEFKRSPVPIVLAASVEE
QEETPSVAIDYEQAIYDAVKLLVDKGHTDIAFVSGPMAEPINRSKKLQGY
KRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEM
ALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV
AMRLLTKLMNKEPVEEHIVELPHRIELRKSTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oqn Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
T5 I6 Y7 M17 S21 Y47 N50 A53 R54 A57
Binding residue
(residue number reindexed from 1)
T4 I5 Y6 M16 S20 Y46 N49 A52 R53 A56
Binding affinityPDBbind-CN: Kd=3.0nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3oqn, PDBe:3oqn, PDBj:3oqn
PDBsum3oqn
PubMed21106498
UniProtP25144|CCPA_BACSU Catabolite control protein A (Gene Name=ccpA)

[Back to BioLiP]