Structure of PDB 3ntw Chain C Binding Site BS02

Receptor Information
>3ntw Chain C (length=56) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEA
MELIVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ntw The MLLE domain of the ubiquitin ligase UBR5 binds to its catalytic domain to regulate substrate binding.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		G2384 E2385 Y2388 S2400 K2401 T2403 G2404 M2405 E2408 L2434
Binding residue
(residue number reindexed from 1)		G3 E4 Y7 S19 K20 T22 G23 M24 E27 L53
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3ntw, PDBe:3ntw, PDBj:3ntw
PDBsum3ntw
PubMed26224628
UniProtQ62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 (Gene Name=Ubr5)

[Back to BioLiP]