Structure of PDB 3nmx Chain C Binding Site BS02

Receptor Information

>3nmx Chain C (length=323) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HHHMLHLLEQIRAYCETCWEWQEAHAPVEHQICPAVCVLMKLSFDEEHRH
AMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVA
NKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLR
EVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALA
FLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQT
LLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSK
HKMIAMGSAAALRNLMANRPAKY

Ligand information

>3nmx Chain F (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GGGEQLAINELIS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3nmx Structural basis for the recognition of Asef by adenomatous polyposis coli.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	F458 M503 N507 F510 G511 K516 Q542 S546 R549 N550 W553 W593 N594
Binding residue (residue number reindexed from 1)	F44 M89 N93 F96 G97 K102 Q128 S132 R135 N136 W139 W179 N180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008013	beta-catenin binding

	Biological Process
GO:0030178	negative regulation of Wnt signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3nmx, PDBe:3nmx, PDBj:3nmx
PDBsum	3nmx
PubMed	21788986
UniProt	P25054\|APC_HUMAN Adenomatous polyposis coli protein (Gene Name=APC)

[Back to BioLiP]