Structure of PDB 3n97 Chain C Binding Site BS02

Receptor Information
>3n97 Chain C (length=74) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKS
LTEIKDVLASRGLSLGMRLENWPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n97 The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element.
Resolution3.252 Å
Binding residue
(original residue number in PDB)		P293 N294 L295 G296 K298 S299
Binding residue
(residue number reindexed from 1)		P44 N45 L46 G47 K49 S50
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3n97, PDBe:3n97, PDBj:3n97
PDBsum3n97
PubMed33205945
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]