Structure of PDB 3lnj Chain C Binding Site BS02

Receptor Information
>3lnj Chain C (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lnj A left-handed solution to peptide inhibition of the p53-MDM2 interaction.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		L54 F55 I61 Y67 Q72 H73 V93 K94 H96 Y100
Binding residue
(residue number reindexed from 1)		L29 F30 I36 Y42 Q47 H48 V68 K69 H71 Y75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lnj, PDBe:3lnj, PDBj:3lnj
PDBsum3lnj
PubMed20449836
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]