Structure of PDB 3bim Chain C Binding Site BS02

Receptor Information
>3bim Chain C (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACS
GLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMA
VMATAMYLQMEHVVDTCRKFIKASE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bim Structure of a BCOR corepressor peptide in complex with the BCL6 BTB domain dimer.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Q8 I9 Q10 F11 T12 R13 D17 N21 R24 R28
Binding residue
(residue number reindexed from 1)
Q4 I5 Q6 F7 T8 R9 D13 N17 R20 R24
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3bim, PDBe:3bim, PDBj:3bim
PDBsum3bim
PubMed18280243
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]