Structure of PDB 2xsd Chain C Binding Site BS02

Receptor Information
>2xsd Chain C (length=128) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEA
LQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITG
LADSLQLEKEVVRVWFCNRRQKEKRMTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xsd Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
Resolution2.049 Å
Binding residue
(original residue number in PDB)		F286 S287 T289 T290 R293 S300 N303 K361 R382 C386 R389 Q390 K393
Binding residue
(residue number reindexed from 1)		F40 S41 T43 T44 R47 S54 N57 K92 R113 C117 R120 Q121 K124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xsd, PDBe:2xsd, PDBj:2xsd
PDBsum2xsd
PubMed21117060
UniProtP21952|PO3F1_MOUSE POU domain, class 3, transcription factor 1 (Gene Name=Pou3f1)

[Back to BioLiP]