Structure of PDB 2wa9 Chain C Binding Site BS02

Receptor Information
>2wa9 Chain C (length=86) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAI
CGVFTAEVAETKVAMVNKYARENEHPLLCTLEKAGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wa9 Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K23 P24 P25
Binding residue
(residue number reindexed from 1)		K1 P2 P3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006508 proteolysis
GO:0009408 response to heat
GO:0030163 protein catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wa9, PDBe:2wa9, PDBj:2wa9
PDBsum2wa9
PubMed19373253
UniProtP0A8Q6|CLPS_ECOLI ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]