Structure of PDB 2ve9 Chain C Binding Site BS02

Receptor Information
>2ve9 Chain C (length=62) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPM
NTNGSREVIAPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ve9 Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
R762 S764 I765 S766 R770 Y776
Binding residue
(residue number reindexed from 1)
R17 S19 I20 S21 R25 Y31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ve9, PDBe:2ve9, PDBj:2ve9
PDBsum2ve9
PubMed18722176
UniProtQ9I0M3|FTSK_PSEAE DNA translocase FtsK (Gene Name=ftsK)

[Back to BioLiP]