Structure of PDB 2nqb Chain C Binding Site BS02

Receptor Information

>2nqb Chain C (length=106) Species: 7227 (Drosophila melanogaster)

AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQA
VLLPKK

Ligand information

>2nqb Chain J (length=146)

atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2nqb Comparative analysis of nucleosome structures from different species.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): R829 R835 R842 V843 G844 K875 T876 R877
• Binding residue (residue number reindexed from 1): R16 R22 R29 V30 G31 K62 T63 R64

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0031492 nucleosomal DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0007526 larval somatic muscle development
• GO:0031507 heterochromatin formation

Cellular Component

• GO:0000786 nucleosome
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005700 polytene chromosome
• GO:0005704 polytene chromosome band

External links

• PDB: RCSB:2nqb, PDBe:2nqb, PDBj:2nqb
• PDBsum: 2nqb
• UniProt: P84051|H2A_DROME Histone H2A (Gene Name=His2A)