Structure of PDB 2mak Chain C Binding Site BS02

Receptor Information
>2mak Chain C (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMASSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTH
EVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKR
Ligand information
>2mak Chain D (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSELNELAEFARLQDQLDHRGDH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mak STIM1/Orai1 coiled-coil interplay in the regulation of store-operated calcium entry.
ResolutionN/A
Binding residue
(original residue number in PDB)		E336 S339 S340 Y342 P344 L351 H355
Binding residue
(residue number reindexed from 1)		E31 S34 S35 Y37 P39 L46 H50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005246 calcium channel regulator activity

View graph for
Molecular Function
External links
PDB RCSB:2mak, PDBe:2mak, PDBj:2mak
PDBsum2mak
PubMed24351972
UniProtQ13586|STIM1_HUMAN Stromal interaction molecule 1 (Gene Name=STIM1)

[Back to BioLiP]