Structure of PDB 2k1n Chain C Binding Site BS02

Receptor Information
>2k1n Chain C (length=55) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKP
NMTCQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k1n Insights into the Nature of DNA Binding of AbrB-like Transcription Factors
ResolutionN/A
Binding residue
(original residue number in PDB)		R8 D11 L13 V17 I18 P19 I20 R23 R24
Binding residue
(residue number reindexed from 1)		R8 D11 L13 V17 I18 P19 I20 R23 R24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2k1n, PDBe:2k1n, PDBj:2k1n
PDBsum2k1n
PubMed19000822
UniProtP08874|ABRB_BACSU Transition state regulatory protein AbrB (Gene Name=abrB)

[Back to BioLiP]