Structure of PDB 2iz9 Chain C Binding Site BS02

Receptor Information
>2iz9 Chain C (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iz9 Deletion of a Single Hydrogen Bonding Atom from the MS2 RNA Operator Leads to Dramatic Rearrangements at the RNA-Coat Protein Interface
Resolution2.85 Å
Binding residue
(original residue number in PDB)
K43 T45 S47 T59 K61 Y85
Binding residue
(residue number reindexed from 1)
K43 T45 S47 T59 K61 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2iz9, PDBe:2iz9, PDBj:2iz9
PDBsum2iz9
PubMed11095669
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]