Structure of PDB 2ivk Chain C Binding Site BS02

Receptor Information

>2ivk Chain C (length=213) Species: 672 (Vibrio vulnificus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APPSSFSAAKQQAVKIYQDHPISFYCGCDIEWQGKKGIPNLETCGYQVRK
QQTRASRIEWEAVVPAWQFGHHRQCWQKGGRKNCSKNDQQFRLMEADLHN
LTPAIGEVNGDRSNFNFSQWNGVDGVSYGRCEMQVNFKQRKVMPPDRARG
SIARTYLYMSQEYGFQLSKQQQQLMQAWNKSYPVDEWECTRDDRIAKIQG
NHNPFVQQSCQTQ

Ligand information

>2ivk Chain H (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aattcgatcgaattc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ivk Structural Basis for Sequence-Dependent DNA Cleavage by Nonspecific Endonucleases.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	R72 W85 W94 R99 N127 S131 N132
Binding residue (residue number reindexed from 1)	R54 W67 W76 R81 N109 S113 N114

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004518	nuclease activity
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2ivk, PDBe:2ivk, PDBj:2ivk
PDBsum	2ivk
PubMed	17175542
UniProt	Q7MHK3

[Back to BioLiP]