Structure of PDB 2dym Chain C Binding Site BS02

Receptor Information
>2dym Chain C (length=251) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHMNDIKQLLWNGELNVLVSIDPSFLMKGSEIAVLRIRVPRETYLVNYMP
LIWNKISEKYFWFEHNKTPIPWNYPVGVLFDCLASFENQVKDVLTFLRIH
LVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNE
ARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRFRISQPTISMT
GVNPTLKDIEGDIDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVP
I
Ligand information
>2dym Chain H (length=24) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SMDDLLIRRLTDRNDKEAHLNELF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dym Structure of Atg5.Atg16, a complex essential for autophagy
Resolution2.2 Å
Binding residue
(original residue number in PDB)		L113 R117
Binding residue
(residue number reindexed from 1)		L94 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0016787 hydrolase activity
GO:0019776 Atg8-family ligase activity
GO:0140355 cargo receptor ligand activity
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0016236 macroautophagy
GO:0032258 cytoplasm to vacuole targeting by the Cvt pathway
GO:0034727 piecemeal microautophagy of the nucleus
GO:0044804 nucleophagy
GO:0051365 cellular response to potassium ion starvation
Cellular Component
GO:0000407 phagophore assembly site
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034274 Atg12-Atg5-Atg16 complex
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0061908 phagophore
GO:0120095 vacuole-isolation membrane contact site
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2dym, PDBe:2dym, PDBj:2dym
PDBsum2dym
PubMed17192262
UniProtQ12380|ATG5_YEAST Autophagy protein 5 (Gene Name=ATG5)

[Back to BioLiP]