Structure of PDB 2czj Chain C Binding Site BS02

Receptor Information
>2czj Chain C (length=118) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDG
ELYLENLYIAPYYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKI
YFNERGYAKVLLGLARGK
Ligand information
>2czj Chain D (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggggugaaacggucucgacagggguucgccuuuggacguggguucgacu
cccaccaccucc
<<<<<<<............<<<<<<....>>>>>>...<<<<<.......
>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2czj Structural basis for functional mimicry of long-variable-arm tRNA by transfer-messenger RNA.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		E21 I24 L26 G28 V31 K32 R35 E52 Y63 Y68 L80 L81 H82 K83 R110 G111 Y112 A113 K114
Binding residue
(residue number reindexed from 1)		E20 I23 L25 G27 V30 K31 R34 E51 Y62 Y63 L75 L76 H77 K78 R105 G106 Y107 A108 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2czj, PDBe:2czj, PDBj:2czj
PDBsum2czj
PubMed17488812
UniProtQ8RR57|SSRP_THET8 SsrA-binding protein (Gene Name=smpB)

[Back to BioLiP]