Structure of PDB 2bnz Chain C Binding Site BS02

Receptor Information

>2bnz Chain C (length=52) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPD
KL

Ligand information

>2bnz Chain F (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctaatcacttgtgattcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2bnz Structures of Omega Repressors Bound to Direct and Inverted DNA Repeats Explain Modulation of Transcription.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	T29 R31
Binding residue (residue number reindexed from 1)	T10 R12
Binding affinity	PDBbind-CN: Kd=20nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Biological Process

External links

PDB	RCSB:2bnz, PDBe:2bnz, PDBj:2bnz
PDBsum	2bnz
PubMed	16528102
UniProt	Q57468

[Back to BioLiP]