Structure of PDB 1zs4 Chain C Binding Site BS02

Receptor Information
>1zs4 Chain C (length=79) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSM
LLAVLEWGVVDDDMARLARQVAAILTNKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zs4 Crystal Structure of Bacteriophage lambdacII and Its DNA Complex.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
D36 S38 Q39 W43
Binding residue
(residue number reindexed from 1)
D33 S35 Q36 W40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1zs4, PDBe:1zs4, PDBj:1zs4
PDBsum1zs4
PubMed16039594
UniProtP03042|RPC2_LAMBD Transcriptional activator II (Gene Name=cII)

[Back to BioLiP]