Structure of PDB 1zla Chain C Binding Site BS02

Receptor Information
>1zla Chain C (length=107) Species: 263730 (Expression vector pET3-H2A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPKKT
Ligand information
>1zla Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zla The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R829 R835 R842 V843 G844 K875 T876 R877
Binding residue
(residue number reindexed from 1)		R16 R22 R29 V30 G31 K62 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1zla, PDBe:1zla, PDBj:1zla
PDBsum1zla
PubMed16469929
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]